-39%
Таро пространства вариантов. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг + 78 карт)

Таро пространства вариантов. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг + 78 карт)

-Вес: 1495
-Ширина упаковки: 215
-Высота упаковки: 75
-Глубина упаковки: 215
-crossborder: False

3 885 ₽
2 362 ₽
OZON.RU
-33%
Вадим Зеланд. Трансерфинг реальности. Ступень 1-5. Говард Брокман. Исцеление Живой Энергией. В 2 книгах. Книга 1 (комплект из 2 книг)

Вадим Зеланд. Трансерфинг реальности. Ступень 1-5. Говард Брокман. Исцеление Живой Энергией. В 2 книгах. Книга 1 (комплект из 2 книг)

-Вес: 1190
-Ширина упаковки: 150
-Высота упаковки: 60
-Глубина упаковки: 230
-crossborder: False

Вашему вниманию предлагается комплект из 2 книг: \"Трансерфинг реальности. Ступень 1-5\" и \"Исцеление Живой Энергией. В 2 книгах. Книга 1\". Рекомендуем!

2 606 ₽
1 746 ₽
OZON.RU
-31%
Трансерфинг реальности (комплект из 7 книг)

Трансерфинг реальности (комплект из 7 книг)

-Вес: 1100
-Ширина упаковки: 140
-Высота упаковки: 80
-Глубина упаковки: 210
-crossborder: False

Вашему вниманию предлагается комплект из 7 книг \"Трансерфинг реальности\". Рекомендуем!

2 469 ₽
1 712 ₽
OZON.RU
-30%
Трансерфинг реальности. Ступени 2-5 (комплект из 4 книг)

Трансерфинг реальности. Ступени 2-5 (комплект из 4 книг)

-Вес: 565
-Ширина упаковки: 140
-Высота упаковки: 40
-Глубина упаковки: 210
-crossborder: False

Для лиц старше 16 лет предлагается комплект из 4 книг В.Зеланда \"Трансерфинг реальности. Ступени 2-5\". Рекомендуем!

-27%
Вадим Зеланд. Трансерфинг реальности. Ступень 1-5. Рудигер Дальке. Голодайте во благо (комплект из 2 книг)

Вадим Зеланд. Трансерфинг реальности. Ступень 1-5. Рудигер Дальке. Голодайте во благо (комплект из 2 книг)

-Вес: 1090
-Ширина упаковки: 150
-Высота упаковки: 50
-Глубина упаковки: 230
-crossborder: False

Вашему вниманию предлагается комплект из 2 книг: \"Трансерфинг реальности. Ступени 1-5\" и \"Голодайте во благо. Комплексная программа голодания\".

2 769 ₽
2 024 ₽
OZON.RU
-19%
Пробуждение чувств. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг)

Пробуждение чувств. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг)

-Вес: 1380
-Ширина упаковки: 220
-Высота упаковки: 50
-Глубина упаковки: 220
-crossborder: False

1 737 ₽
1 412 ₽
OZON.RU
-12%
Трансерфинг реальности. 1-5 ступени. Голодайте во благо (комплект из 2 книг)

Трансерфинг реальности. 1-5 ступени. Голодайте во благо (комплект из 2 книг)

-Вес: 1310
-Ширина упаковки: 220
-Высота упаковки: 45
-Глубина упаковки: 220
-crossborder: False

2 862 ₽
2 525 ₽
OZON.RU
Трансерфинг реальности. 1-5 ступени (+ аудиокнига \

Трансерфинг реальности. 1-5 ступени (+ аудиокнига \"Апокрифический трансерфинг. Форум сновидений\" MP3 на 4 CD)

-Вес: 1340
-Ширина упаковки: 220
-Высота упаковки: 60
-Глубина упаковки: 220
-crossborder: False

Трансерфинг реальности (ступени 1-5). Всемирная книга сновидений (комплект из 2 книг)

Трансерфинг реальности (ступени 1-5). Всемирная книга сновидений (комплект из 2 книг)

-Вес: 1175
-Ширина упаковки: 140
-Высота упаковки: 60
-Глубина упаковки: 220
-crossborder: False

Национально-освободительное движение в России. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг + видеоприложение на DVD)

Национально-освободительное движение в России. Трансерфинг реальности. 1-5 ступени (комплект из 2 книг + видеоприложение на DVD)

-Вес: 1335
-Ширина упаковки: 220
-Высота упаковки: 50
-Глубина упаковки: 220
-crossborder: False

Проектор отдельной реальности. Практика трансферинга. Практический курс трансферинга. Трансерфинг 1-5 (комплект из 8 книг)

Проектор отдельной реальности. Практика трансферинга. Практический курс трансферинга. Трансерфинг 1-5 (комплект из 8 книг)

-Вес: 1665
-Ширина упаковки: 150
-Высота упаковки: 100
-Глубина упаковки: 220
-crossborder: False

Товары из категории вадим зеланд. трансерфинг реальности. 5
Магия семейного счастья: Советы потомственного знахаря, защита дома и семьи

Магия семейного счастья: Советы потомственного знахаря, защита дома и семьи

-Вес: 310
-Ширина упаковки: 130
-Высота упаковки: 22
-Глубина упаковки: 210
-crossborder: False

Серия \

Серия \"Антология тайн, чудес и загадок\" (комплект из 4 книг)

-Вес: 1585
-Ширина упаковки: 140
-Высота упаковки: 90
-Глубина упаковки: 210
-crossborder: False

Серия \"Антология тайн, чудес и загадок\" (комплект из 4 книг)

Элементарные законы Изобилия

Элементарные законы Изобилия

-Вес: 683
-Ширина упаковки: 130
-Высота упаковки: 30
-Глубина упаковки: 213
-crossborder: False

Аннотация Богатство не нуждается в оправданиях, хотя часто оно оказывается на противоположной чаше весов, когда речь идет о духовных ценностях. Однако настоящее Изобилие - это заветная точка равновесия между просветленным сознанием и солидным счетом в банке, достичь которой вполне реально одним лишь усилием мысли.

Принимая дары Вселенной, вы создаете роскошь для себя и окружающих и испытываете при этом всеобъемлющую радость.

.

Талисманы, обереги, амулеты

Талисманы, обереги, амулеты

-Вес: 175
-Ширина упаковки: 130
-Высота упаковки: 3
-Глубина упаковки: 200
-crossborder: False

Талисманы имеют мощную энергетическую силу и символическое значение. Задача талисманов - притягивать желаемые события и явления.

Они поддерживают и усиливают личные положительные качества и способности, данные от природы. Они создают внутреннюю гармонию между человеком и окружающим миром, помогают успешно противостоять трудностям, возникающим в нашей жизни.

Амулеты защищают и охраняют от различных негативных влияний и событий,.

Как заниматься медиумическими толкованиями с помощью прикосновения

Как заниматься медиумическими толкованиями с помощью прикосновения

-Вес: 197
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 180
-crossborder: False

Тэд Эндрюс - знаменитый исследователь и преподаватель в области метафизических и духовных наук. Он является автором более десяти книг, популярных во всем мире.

На страницах этого учебника Тэд Эндрюс представляет позитивную и наглядную систему для развития экстрасенсорных возможностей каждого человека. Вы научитесь основам психометрии, поймете причины ее действия и овладеете простыми методами самостоятельной работы.

Используя.

Путь Посвящений

Путь Посвящений

-Вес: 255
-Ширина упаковки: 140
-Высота упаковки: 15
-Глубина упаковки: 200
-crossborder: False

Татьяна Николаевна Микушина с марта 2005 г. регулярно принимает диктовки от Вознесенных Владык - Учителей человечества, пребывающих на тонком плане, проводит обучающие семинары. Книга содержит диктовки и фрагменты из диктовок, которые раскрывают тему семинара \"Путь Посвящений\", состоявшегося под Москвой в марте 2007 г.

Заговоров и оберегов от порчи и сглаза

Заговоров и оберегов от порчи и сглаза

-Вес: 241
-Ширина упаковки: 133
-Высота упаковки: 10
-Глубина упаковки: 203
-crossborder: False

Заговоры и обереги известной сибирской целительницы Н.И.

Степановой помогли тысячам людей выйти из самых сложных ситуаций: вернули здоровье, помогли улучшить семейные отношения, наладить удачный бизнес.Если у вас резко и, казалось бы, беспричинно ухудшилось здоровье, испортились отношения с родными, стал рушиться бизнес, то, возможно, вы подверглись воздействию сглаза или на вас навели порчу.

Обратитесь к книгам Степановой - и помощь.

Геометрия Бога. Мистический язык символов

Геометрия Бога. Мистический язык символов

-Вес: 301
-Ширина упаковки: 148
-Высота упаковки: 11
-Глубина упаковки: 210
-crossborder: False

Книга «Геометрия Бога» наиболее иррациональная из всех книг серии «Эзотерика истоков». Она предназначена для читателя, ищущего сокровенные знания, слушающего и слышащего себя и окружающее пространство.В текстах исследуются и описываются мир геометрических фигур, геометрическое строение вселенной, энергоинформационные модули, эзотерическая символика, пирамиды, некоторые янтры и мандалы, при помощи которых можно осознанно.

Таро Манара. Магия любви

Таро Манара. Магия любви

-Вес: 565
-Ширина упаковки: 148
-Высота упаковки: 21
-Глубина упаковки: 210
-crossborder: False

Данная книга поможет вам легко ориентироваться в непростом мире человеческих взаимоотношений, понять, чего ждать от себя и от своего партнера в жизни. Как лучше узнать любимого, какой путь выбрать в чарующей стране любви - все это можно выяснить с помощью колоды Таро Манара.

Слова-лекари от душевных и телесных недугов

Слова-лекари от душевных и телесных недугов

-Вес: 700
-Ширина упаковки: 133
-Высота упаковки: 29
-Глубина упаковки: 203
-crossborder: False

Слово обладает огромной энергией, оно способно врачевать душевные раны и избавлять от телесных недугов. Наши далекие предки не могли пользоваться услугами дипломированных врачей, они не пили таблеток и не лежали в больницах, а от своих болезней избавлялись с помощью знахарей и народных целителей, владевших секретами заговорного слова.

Некоторые из этих секретов давно утрачены, но многое еще сохранилось до наших дней. Словом.

.

Mente Magnetica. A Ciencia para Atrair Riqueza, Prosperidade e Tudo Mais que Voce Desejar

Mente Magnetica. A Ciencia para Atrair Riqueza, Prosperidade e Tudo Mais que Voce Desejar

-Вес: 193
-Ширина упаковки: 152
-Высота упаковки: 6
-Глубина упаковки: 229
-crossborder: False

Книга #34;Mente Magnética. A Ciência para Atrair Riqueza, Prosperidade e Tudo Mais que Você Desejar #34;.

Você atrai para si aquilo que pensa. Neste momento a Lei da Atração está regendo todos os acontecimentos da sua vida, entretanto ela só funcionará à seu favor se você souber usá-la conscientemente.

 Neste livro Rogerio Job mostra a ciência e um método prático para você usar a mente de modo consciente para atrair a realização de seus desejos, sonhos e metas. No livro o autor conta como ele próprio utilizou este método para sair do fracasso total e começar uma jornada de realizações.

 Através deste livro você terá acesso, como Bônus, à um método em áudio chamado #34;Programação Mental Magnética #34; que ajudará você a entrar em estado Alpha e.

Жизнь в чужом теле

Жизнь в чужом теле

-Вес: 345
-Ширина упаковки: 148
-Высота упаковки: 13
-Глубина упаковки: 210
-crossborder: False

Книга знакомит читателя с построением программы жизни человека и особенностями формирования Высшими Силами его Судьбы. Раскрываются тайны записи программ на тонких оболочках души, тайны управления программами временем и построения голографических ситуаций жизни. Книга также повествует об энергетических особенностях архитектуры зданий, о загадках ясновидения, вампиризма, посещениях инопланетянами Земли в прошлых цивилизациях.

Путник сновидений. 4 часть. Выбор: реальность или сновидения

Путник сновидений. 4 часть. Выбор: реальность или сновидения

-Вес: 184
-Ширина упаковки: 120
-Высота упаковки: 188
-Глубина упаковки: 10
-crossborder: False

Впервые в серии \"Хакеры Сновидений\" выходит книга, автор которой не является членом группы ХС. Но он оказался здесь неслучайно - Владимира Путника нашли сами Хакеры и предложили издательству опубликовать его книгу в этой серии.

Удивительно то, что В. Путник, не используя методы и техники ХС, не участвуя в их виртуальных семинарах, нашел свой собственный \"ключ\" к осознанным сновидениям и пришел к тем же результатам, что и Хакеры.

.

Theorie der Geister-Kunde

Theorie der Geister-Kunde

-Вес: 481
-Ширина упаковки: 148
-Высота упаковки: 17
-Глубина упаковки: 210
-crossborder: False

Эта книга — репринт оригинального издания (издательство #34;Leipzig, Verlag von Karl Fr. Pfau #34;, 1903 год), созданный на основе электронной копии высокого разрешения, которую очистили и обработали вручную, сохранив структуру и орфографию оригинального издания. Редкие, забытые и малоизвестные книги, изданные с петровских времен до наших дней, вновь доступны в виде печатных книг.

1 479 ₽
1 168 ₽
OZON.RU
Как благополучие сберечь и упрочить

Как благополучие сберечь и упрочить

-Вес: 319
-Ширина упаковки: 133
-Высота упаковки: 13
-Глубина упаковки: 203
-crossborder: False

.

.Сильные мира сего пытались заручиться поддержкой могущественных магов и узнать свою судьбу.

Гадали и обыкновенные люди, желавшие узнать о будущем урожае, о том, когда их ждет удача и что может угрожать их благополучию, о том, как добиться успеха. Благодаря этой книге и вы сможете не только заглянуть в грядущее, получить совет или предостережение, но и защитить себя с помощью старинных обрядов, заговоров, оберегов.

Счастья,.

Ступени к вашему счастью. Устраняем родовые ошибки

Ступени к вашему счастью. Устраняем родовые ошибки

-Вес: 350
-Ширина упаковки: 140
-Высота упаковки: 20
-Глубина упаковки: 220
-crossborder: False

Новая книга от Фатимы Хадуевой! Истории из жизни, секреты мастерства. Это не просто книга, это дневник для самостоятельной работы и прогресса!Говорят, судьбу не изменить.

Также говорят - судьба в твоих руках. Где же Истина? Не надо Ее искать, она сама с вами случится! Живите сердцем, слушайте свою Душу! Эта книга больше для тех, кто готов учиться на чужих ошибках.

Вспомните о своих.

. и успейте их исправить!Духовные практики, учителя -.

.

Русская революция и Махатмы

Русская революция и Махатмы

-Вес: 265
-Ширина упаковки: 135
-Высота упаковки: 12
-Глубина упаковки: 205
-crossborder: False

Новая Россия названа Махатмами страной будущего. Об отношении Махатм к Русской революции, о миссии России и её роли в глобальном устроении третьего тысячелетия, о Новой Азии, о балансе цивилизаций, заповеданном Союзе Востока и Союзе Мира написана книга РУССКАЯ РЕВОЛЮЦИЯ И МАХАТМЫ.

Книга Теней Таро

Книга Теней Таро

-Вес: 140
-Ширина упаковки: 125
-Высота упаковки: 6
-Глубина упаковки: 195
-crossborder: False

Книга Теней - это сборник инкунабул, которым обладают некоторые языческие колдуньи и ведьмы, в котором содержатся их тайные знания о ритуалах, магических приёмах и этапах личного духовного пути. Заметки о магических приёмах перемежаются на страницах Книги памятками, дневниковыми записями, зарисовками, и отражают личность их создателя и хозяина.

В процессе работы некоторые страницы могут склеиться, рисунки смазаться. Схемы и.

.

Шаманизм - сила от природы

Шаманизм - сила от природы

-Вес: 775
-Ширина упаковки: 150
-Высота упаковки: 30
-Глубина упаковки: 220
-crossborder: False

Окружающая нас живая природа наделена нескончаемым запасом жизненной силы. Человек, являясь частью биосферы, окружен этой силой, но не видит ее, потребляя только небольшую внешнюю часть - разрушающуюся и не подлежащую восстановлению.

Воспользоваться этой естественной силой можно, вступив с природой в особые отношения, знания о которых сохранили шаманы - реальные практики жизни в гармонии со всеми мирами вселенной. Эта работа.

.

1 271 ₽
1 052 ₽
OZON.RU
Путь воды. Женщины медитируют иначе. Жизнь есть экстаз. Медитация, любовь и секс (комплект из 3 книг)

Путь воды. Женщины медитируют иначе. Жизнь есть экстаз. Медитация, любовь и секс (комплект из 3 книг)

-Вес: 945
-Ширина упаковки: 150
-Высота упаковки: 50
-Глубина упаковки: 220
-crossborder: False

В комплект вошли следующие издания: 1. Катрин Джонас: Путь воды.

Женщины медитируют иначе 2. Ошо: Жизнь есть экстаз.

Практика активных медитаций 3. Ошо: Медитация, любовь и секс - танец твоего существа .

Десять посланий от ангелов к тебе

Десять посланий от ангелов к тебе

-Вес: 85
-Ширина упаковки: 127
-Высота упаковки: 12
-Глубина упаковки: 200
-crossborder: False

Существование ангелов признают практически все духовные традиции мира. Само слово ангел означает \"посланник Бога\".

Ангелы могут помогать наставлением и вдохновением каждому человеку, независимо от его религиозной принадлежности, но не все готовы их слушать и слышать. Дорин Вёрче, ясновидящая с детства, умеет слышать ангелов и записывать их слова.

В этой книге она собрала десять мудрых посланий от ангелов лично к вам! Они.

Сибирская книга мертвых

Сибирская книга мертвых

-Вес: 285
-Ширина упаковки: 140
-Высота упаковки: 25
-Глубина упаковки: 210
-crossborder: False

«Сибирская книга мертвых» — это собрание заговоров, обрядов и тайных практик, связанных с миром смерти. Все эти сведения столетиями хранились в семье потомственной сибирской целительницы Натальи Степановой.

Смерть участвует в цикле постоянного перерождения природы. Многие магические ритуалы и обрядовые практики разных культур испокон веков были связаны с представлениями человечества о загробном мире.

В русской заговорной.

Нострадамус. Полное собрание пророчеств

Нострадамус. Полное собрание пророчеств

-Вес: 1120
-Ширина упаковки: 180
-Высота упаковки: 50
-Глубина упаковки: 250
-crossborder: False

Впервые на русском языке издано единственное признанное в мире полное собрание пророчеств Мишеля Нострадамуса с комментариями Джона Хоуга - непревзойденного знатока творческого наследия великого ясновидца. Эта книга как по глубине, так и по объему исследований стала эталоном работ о пророке. Пророчества Мишеля Нострадамуса, отличающиеся бесхитростной точностью, вот уже четыре века продолжают неумолимо сбываться, ошеломляя и.

Вангелия. Привлечение счастья и благополучия по методам Ванги

Вангелия. Привлечение счастья и благополучия по методам Ванги

-Вес: 285
-Ширина упаковки: 140
-Высота упаковки: 20
-Глубина упаковки: 205
-crossborder: False

Великая болгарская целительница и прорицательница Ванга всю свою жизнь стремилась делать людям добро. Из тысяч людей, которым она помогла, очень немногим довелось хотя бы недолгое время побыть ее учениками.

Далеко не все из них рассказывали о своем знакомстве с ней - стеснялись, боялись, что им не поверят. Но пришло время - и оказалось, что информацию, которую им передала Ванга, скрывать стало уже невозможно: ведь знание передавалось.

.

Настольный календарь знахаря

Настольный календарь знахаря

-Вес: 630
-Ширина упаковки: 150
-Высота упаковки: 40
-Глубина упаковки: 220
-crossborder: False

Вы держите в руках календарь народной мудрости, полный свод проверенных веками правил, обычаев и примет. Такой ежедневник пригодится каждому, кто хочет жить в единении с ритмами природы.

И каждому, кто хочет выучить тайный язык, на котором природа с нами разговаривает. Из этой книги вы узнаете, почему ранней весной принято обходить по кругу колодцы, что такое прыгун-трава и где ее найти, почему желающие разбогатеть носят в кармане.

.

Алгебра сигнатур \

Алгебра сигнатур \"Частицы\"

-Вес: 465
-Ширина упаковки: 145
-Высота упаковки: 10
-Глубина упаковки: 215
-crossborder: False

Книга \"Частицы\" является очередной частью единого исследования под общим названием \"Алгебра сигнатур\". В данной части Алсигны исследуется структура элементарных частиц, развиваются и конкретизируются основы геометризированной вакуумной \"электродинамики\" и излагаются основы геометризированной теории внутриядерных процессов на базе представлений о \"пустоте\" (вакууме), изложенных в \"оранжевой\" и \"желтой\" частях этого проекта..

Заговоры сибирской целительницы

Заговоры сибирской целительницы

-Вес: 260
-Ширина упаковки: 140
-Высота упаковки: 15
-Глубина упаковки: 210
-crossborder: False

Книга, которую вы держите в руках — удивительная. В ней собраны все обережные заговоры, которые называют Снами Пресвятой Богородицы.

Эти чудодейственные сны могут помочь вам в самые тяжелые и темные дни. С их помощью вы сможете исцелиться от недугов, с которыми давно уже смирились, вернуть в свою жизнь счастье и любовь.

В книге все семьдесят семь Снов Пресвятой Богородицы разделены тематически: заговоры для семьи, для здоровья, для.

Энергия сотворения. Слово о Докторе. Информационно-энергетическое Учение. Начальный курс

Энергия сотворения. Слово о Докторе. Информационно-энергетическое Учение. Начальный курс

-Вес: 135
-Ширина упаковки: 130
-Высота упаковки: 20
-Глубина упаковки: 200
-crossborder: False

Перед вами книга медицины будущего, книга, которая действительно лечит. Уже многим она помогла избавиться от болезней.

Ведь процесс исцеления начинается уже с момента начала ее чтения. Энергетические упражнения, целительный буклет и методика заочного сеанса дадут вам шанс избавиться от болезней и бед, обрести смысл жизни, вступить в контакт с целительной Энергией Сотворения.

Эта книга рассказывает о необычном Докторе, который.

Послания стихий. Архетипы Таро. Карты Таро в работе психолога. На языке карт Таро (комплект из 3 книг + колода из 78 карт)

Послания стихий. Архетипы Таро. Карты Таро в работе психолога. На языке карт Таро (комплект из 3 книг + колода из 78 карт)

-Вес: 1270
-Ширина упаковки: 160
-Высота упаковки: 80
-Глубина упаковки: 235
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"Архетипы Таро. Психологический практикум\" \"Карты Таро в работе психолога\" \"На языке карт Таро. Психологические заметки таролога\" \"Послания стихий. Карты Таро (78 карт)\"

1 927 ₽
1 751 ₽
OZON.RU
Ввод в тему. Книга 1. Хронолого-эзотерический анализ развития современной цивилизации

Ввод в тему. Книга 1. Хронолого-эзотерический анализ развития современной цивилизации

-Вес: 450
-Ширина упаковки: 145
-Высота упаковки: 20
-Глубина упаковки: 215
-crossborder: False

В этой книге подробно изложен новый взгляд на историю человеческой цивилизации, очищенный от вымыслов и манипуляций. Даны объяснения новейшим археологическим открытиям, не вписывающимся в школьные представления о прошлом.

Подробно показано действие тех сил, которые управляют ходом исторических процессов на нашей планете. Описан механизм гибели государств Шумера, Аккада, царства Хеттов, Египта, Рима и Византии.

Его экономические,.

Практики гадания. Расклады Таро

Практики гадания. Расклады Таро

-Вес: 370
-Ширина упаковки: 140
-Высота упаковки: 25
-Глубина упаковки: 210
-crossborder: False

В книге собран новейший опыт тарологов-консультантов, работающих в России. Эта книга - результат ежедневной работы с картами Таро многих людей.

Каждый человек уникален и неповторим, у каждого - свой жизненный опыт и свое мировоззрение. Авторы раскладов и примеров - настоящие мастера своего дела.

Вы можете встретиться на страницах этого сборника с такими мэтрами как Феликс Эльдемуров, Евгений Колесов, Алексей Лобанов, а также менее.

Откровения ангелов-хранителей. Начало

Откровения ангелов-хранителей. Начало

-Вес: 285
-Ширина упаковки: 140
-Высота упаковки: 20
-Глубина упаковки: 210
-crossborder: False

Вниманию читателей предлагается уникальное издание - книга, вместе с которой в ваш дом войдет ангел-хранитель. Она поможет многим людям стать мудрее и настроить свое сердце на добро и любовь.

Розенкрейцеры. Из молчания - свет

Розенкрейцеры. Из молчания - свет

-Вес: 350
-Ширина упаковки: 180
-Высота упаковки: 30
-Глубина упаковки: 250
-crossborder: False

Повествование о Братстве Розы и Креста похоже на миф. Для обычного человека таинственное появление и столь же таинственное исчезновение розенкрейцеров - всего лишь загадка истории, будоражащая воображение; для посвященного эти исторические события имеют особый смысл.

Данная книга приоткрывает завесу над тайной розенкрейцеров. Из нее читатель узнает о том, кто такие розенкрейцеры и каковы были предпосылки их появления,.

.

Spiritual Life and the Word of God

Spiritual Life and the Word of God

-Вес: 184
-Ширина упаковки: 152
-Высота упаковки: 6
-Глубина упаковки: 229
-crossborder: False

An Unabridged Edition To Include: How Spiritual Life Is Acquired - Goods Of Charity - Shunning Evils - Cleansing The Inside - What Religion Consists In - The First Commandment - The Second Commandment - The Third Commandment - The Fourth Commandment - The Fifth Commandment - The Sixth Commandment - The Seventh Commandment - The Eighth Commandment - The Ninth And Tenth Commandments - The Commandments In General - Goods And Truths And Their Opposites - The First Kind Of Profanation - The Second Kind Of Profanation - The Third Kind Of Profanation - The Fourth And Fifth Kinds Of Profanation - The Holiness Of The Word - The Lord Is The Word - The Lord #39;s Words Spirit And Life - Influx And Correspondence - The Three Senses Of The Word - Conjunction By The Word - The Sense Of The Letter

The Vital Message

The Vital Message

-Вес: 258
-Ширина упаковки: 148
-Высота упаковки: 9
-Глубина упаковки: 210
-crossborder: False

Эта книга — репринт оригинального издания, созданный на основе электронной копии высокого разрешения, которую очистили и обработали вручную, сохранив структуру и орфографию оригинального издания. Редкие, забытые и малоизвестные книги, изданные с петровских времен до наших дней, вновь доступны в виде печатных книг.

С любовью, Ошо. Заря Айваза. Здоровая жизнь в болезни и боли (комплект из 3 книг)

С любовью, Ошо. Заря Айваза. Здоровая жизнь в болезни и боли (комплект из 3 книг)

-Вес: 1275
-Ширина упаковки: 170
-Высота упаковки: 55
-Глубина упаковки: 235
-crossborder: False

В данный комплект вошли следующие книги:1. С любовью, Ошо.

120 писем об осознанности.2.

Заря Айваза. Путь к осознанности.

3. Здоровая жизнь в болезни и боли.

Осознанный путь освобождения от страдания. .

Letting Go Into Perfect Love. Discovering the Extraordinary After Abuse

Letting Go Into Perfect Love. Discovering the Extraordinary After Abuse

-Вес: 251
-Ширина упаковки: 140
-Высота упаковки: 9
-Глубина упаковки: 216
-crossborder: False

Книга #34;Letting Go Into Perfect Love. Discovering the Extraordinary After Abuse #34;.

So Daisys Really Are Made In Heaven

So Daisys Really Are Made In Heaven

-Вес: 96
-Ширина упаковки: 148
-Высота упаковки: 3
-Глубина упаковки: 210
-crossborder: False

I wake up and feel my hands to see if I still exist. I do, and I wasn #39;t dreaming.

I #39;ve always felt my life has been different but I never thought that something like this would ever happen to me. It’s like being in a fairytale, or an imaginary dream - but this is reality.

Over the past few years my life and awareness have changed. I always thought that there must be much more to life than what we all see - but how to connect, how to get in touch with the deeper, inner self?There has to be one truth, one ultimate knowledge.

One everlasting and totally understandable definition of life, of where we have come from, where we are going, and what has created us. What is our relationship with this awesome power of creation? .

What Jesus Was Really Saying. how we turned his teachings upside down

What Jesus Was Really Saying. how we turned his teachings upside down

-Вес: 141
-Ширина упаковки: 111
-Высота упаковки: 8
-Глубина упаковки: 178
-crossborder: False

I tell you, the one who believes in me will also do the works that I do and, in fact, will do greater works than these. #39; (John 14:12)What if Jesus wasn #39;t the #39;son of God #39;? What if God doesn #39;t even exist.

.

at least not as any sort of entity separate from each of us? What if, even, we ourselves are just as divine as Jesus was?Could it be that he was trying to tell us that, in our own right, each and every one of us is already a #39;creator god #39; of the highest order? Could that be the #39;good news #39; he was trying to give us?How absurd would it be if, instead of setting him on a pedestal and making him into yet another figure of worship, we were supposed to realise we #39;re his equals and copy him? If, instead of prostrating ourselves at his feet, we were supposed.

Was bin ich, wenn ich bin?

Was bin ich, wenn ich bin?

-Вес: 125
-Ширина упаковки: 127
-Высота упаковки: 5
-Глубина упаковки: 203
-crossborder: False

Andreas Wolf von Guggenbergers spirituelle Novelle Was bin ich, wenn ich bin?Andreas Wolf von Guggenbergers spirituelle Novelle #34;Was bin ich, wenn ich bin? #34; ist eine ergreifende Suche nach den Wurzeln des Menschlichen und nach dem Wert der Liebe. Das Buch gibt auf leicht lesbare Weise einen ersten Einblick in die Gedankenwelt des Autors, die er in seinen Büchern: #34;Wandern auf dem inneren Weg #34; und #34;Evolution der Seele und der Schöpfung #34;, #34;Der Mensch und die Wirkung seiner Seele #34; und #34;Liebe #34;, breit und tief entwickelt.

Heiko, ein Mann in mittleren Jahren, steht vor dem Nichts: Seine Frau hat ihn verlassen, und seine Firma ist pleite. Ein Freund überredet den Verzweifelten zu einem Trip in die Wüste.

Am Lagerfeuer treffen sie auf Mohamed, einen.

Nikola Tesla Presents. : Afterlife Lessons from Famous Personalities

Nikola Tesla Presents. : Afterlife Lessons from Famous Personalities

-Вес: 417
-Ширина упаковки: 152
-Высота упаковки: 14
-Глубина упаковки: 229
-crossborder: False

In the years Nikola Tesla and Francesca Thoman have worked together, they have encountered several other afterlife personalities, both famous and unknown. In this Award Winning book, Nikola Tesla shares what he has learned from these other spirits, who are eager to communicate the wisdom they have discovered since their deaths.

Offering numerous delightfully rich articles with thoughtful, deep and creative information, a panoply of writers, composers, shamans, scientists, Suffragettes, statesmen and several others, including some Nikola Tesla knew in his previous life, have shared what they wish with him. Following Nikola Tesla #39;s lead, Francesca also presents the wisdom of several deceased personalities, channeling them directly so that their personalities come through even more.

.

Lichtheiler

Lichtheiler

-Вес: 178
-Ширина упаковки: 148
-Высота упаковки: 6
-Глубина упаковки: 210
-crossborder: False

Eine Zusammenfassung der Grundlagen energetischer Heil-Behandlungen und eines gesunden Lebens-Stils.Es braucht keine Einweihungen, keine Symbole, keine seitenlangen Theorien.

Die Zeiten der Geheimnisse sind vorbei. So werden in diesem Buch die Informationen in einem klaren Schreibstil auf den Punkt gebracht.

Das Buch eignet sich so zum Lernen, Vertiefen und als Nachschlagewerk.Jeder Mensch hat die Fähigkeit in sich Selbstheilungskräfte in sich, als auch in anderen, zu aktivieren.

Die Lebensenergie, welche die Pflanzen wachsen und die Natur erblühen lässt, kann gezielt für Heilung eingesetzt werden.In diesem Buch erfährst Du viel über das Wunder der Energiearbeit.

Es liegt an Dir, ob Du Dich darauf einlassen möchtest.Im Einzelnen wird erklärt, was Energie letztlich ist.

Wissenwertes.

FALSE FLAG

FALSE FLAG

-Вес: 209
-Ширина упаковки: 152
-Высота упаковки: 7
-Глубина упаковки: 229
-crossborder: False

Книга #34;FALSE FLAG #34;.

Chrysal. Or, the Adventures of a Guinea. Wherein Are Exhibited Views of Several Striking Scenes, With Curious and Interesting Anecdotes of the Most Noted Persons in Every Rank of Life, Whose Hands It Passed Through, in America, England, Holland, G...

Chrysal. Or, the Adventures of a Guinea. Wherein Are Exhibited Views of Several Striking Scenes, With Curious and Interesting Anecdotes of the Most Noted Persons in Every Rank of Life, Whose Hands It Passed Through, in America, England, Holland, G...

-Вес: 521
-Ширина упаковки: 156
-Высота упаковки: 16
-Глубина упаковки: 234
-crossborder: False

Книга #34;Chrysal. Or, the Adventures of a Guinea.

Wherein Are Exhibited Views of Several Striking Scenes, With Curious and Interesting Anecdotes of the Most Noted Persons in Every Rank of Life, Whose Hands It Passed Through, in America, England, Holland, Germany, #34;.This work has been selected by scholars as being culturally important and is part of the knowledge base of civilization as we know it.

This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.

Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. To.

.

Three Books of Occult Philosophy Or Magic. Book One - Natural Magic; Volume Book One - Natural Magic

Three Books of Occult Philosophy Or Magic. Book One - Natural Magic; Volume Book One - Natural Magic

-Вес: 518
-Ширина упаковки: 156
-Высота упаковки: 16
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important and is part of the knowledge base of civilization as we know it.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public.

To ensure a quality reading experience, this work has been proofread and republished using a format that seamlessly blends the original graphical elements with text in an easy-to-read typeface.We appreciate your support of the preservation process, and thank you for being an.

.

Spiritual Fragments

Spiritual Fragments

-Вес: 444
-Ширина упаковки: 156
-Высота упаковки: 14
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible.

Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures,.

.

The Mediated Learning Experience in Action

The Mediated Learning Experience in Action

-Вес: 405
-Ширина упаковки: 152
-Высота упаковки: 13
-Глубина упаковки: 229
-crossborder: False

This book is a hands-on description of the application of the academic therapy methods developed by Professor Reuven Feuerstein to remediate and elaborate the skills and functions of young children who are experiencing a variety of learning disabilities and delays, based on his theories of structural cognitive modifiability (SCM) and the application of mediated learning experience (MLE).The lead author is an experienced educational therapist who has worked with a variety of children, initially in the Feuerstein Institute (formerly the International Center for the Enhancement of Learning Potential [ICELP]) in Jerusalem, Israel.

This experience under the supervision of Professor Feuerstein and his staff is the basis for the content of this book. Her case studies have been elaborated to.

.

Erfullung

Erfullung

-Вес: 274
-Ширина упаковки: 148
-Высота упаковки: 10
-Глубина упаковки: 210
-crossborder: False

„Erfüllung -Mach das Unmögliche möglich #34; ist die Quintessenz einer über 35 jährigen Erfahrung als Hypnotherapeut und Coach. In diesen Jahren hat sich das physikalisch-wissenschaftliche Weltbild dramatisch verändert und auch die Wege für die seelisch-geistige Befreiung des Menschen.

Das Buch vermittelt die Grundlagen mit denen eine Bewusstseinsveränderung heute erreicht werden kann. Es liefert einen neuen Rahmen, um den Wesenskern des Menschen zu offenbaren.

Dabei führt es den Leser zu seinen begrenzenden Glaubenssystemen und eröffnet ihm Methoden sich dauerhaft von ihnen zu befreien. Hier ist ein erprobter, spiritueller Weg für inneres Wachstum beschrieben, der über alle wissenschaftlichen Aspekte transzendiert.

Der Autor schreibt:„Um Erfüllung in deinem Leben zu.

Psycho-Spirituelles Wachstum

Psycho-Spirituelles Wachstum

-Вес: 332
-Ширина упаковки: 148
-Высота упаковки: 12
-Глубина упаковки: 210
-crossborder: False

Nach unerwarteten aussersinnlichen Erfahrungen, die ihr ursprüngliches Weltverständnis und Menschenbild in Frage stellten, suchte die Autorin nach adäquaten Antworten um ihre Erlebnisse einzuordnen. Im vorliegenden Buch macht sie sich grundlegende Gedanken zu den Themen Spiritualität, Menschenbild und persönlicher Glauben.

Sie schlägt einen zeitgemässen und selbstverantwortlichen Zugang zum Transpersonalen vor, der unabhängig von Religion und spirituellen Ideologien ist.Die Autorin fordert geistige Offenheit gegenüber unkonventionellem subjektivem Wissen, wie dem von Sensitiven oder langjährig Meditierenden, deren Erfahrung durch innere oder aussersinnliche Wahrnehmung geprägt ist.

Dieses Wissen sollte ihrer Meinung nach, neben dem rein wissenschaftlichen und als objektiv.

Commentaries on the Golden Dawn Flying Rolls

Commentaries on the Golden Dawn Flying Rolls

-Вес: 694
-Ширина упаковки: 152
-Высота упаковки: 23
-Глубина упаковки: 229
-crossborder: False

This book contains the 36 pivotal papers given to Adepts in the original Golden Dawn order, providing key insights and instructions into the theory and practice of magic, from theurgy, imagination and symbolism to clairvoyance, divination and telesmatic images. For the first time these texts are brought together in a single printed volume, along with some rare administrative versions that were all but ignored by modern eyes.

In addition, extensive and insightful commentaries from modern Golden Dawn magicians from a variety of orders are here provided, adding to the corpus of teaching provided in the Flying Rolls themselves.The contributors to this book include:Frater A.

M., Frater AR, Deanna Bonds, Christopher Bradford, Chic Cicero, Sandra Tabatha Cicero, Ian Cowburn, Morgan Drake Eckstein,.

.

Далее >>>